PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna00185.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 327aa    MW: 35107.7 Da    PI: 10.0349
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna00185.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.81.3e-181560147
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                             +g+W++eEde l ++v+ +G+++W++I++ ++ gR++k+c++rw + 
  mrna00185.1-v1.0-hybrid 15 KGPWSPEEDEALQRLVQSYGPRNWSLISKSIP-GRSGKSCRLRWCNQ 60
                             79******************************.***********985 PP

2Myb_DNA-binding54.72.4e-1769111347
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              ++T+eEd+ +++a++++G++ W+tI+r ++ gRt++ +k++w++ 
  mrna00185.1-v1.0-hybrid  69 PFTPEEDDTIIRAHARFGNK-WATISRLLN-GRTDNAIKNHWNST 111
                              89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.7171065IPR017930Myb domain
SuperFamilySSF466892.43E-3212108IPR009057Homeodomain-like
SMARTSM007175.2E-171463IPR001005SANT/Myb domain
PfamPF002492.9E-181560IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.8E-261668IPR009057Homeodomain-like
CDDcd001672.92E-161759No hitNo description
SMARTSM007179.0E-1566114IPR001005SANT/Myb domain
PROSITE profilePS5129419.65867116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-2369115IPR009057Homeodomain-like
PfamPF002494.4E-1569111IPR001005SANT/Myb domain
CDDcd001677.22E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MASSSTKKAA ADRIKGPWSP EEDEALQRLV QSYGPRNWSL ISKSIPGRSG KSCRLRWCNQ  60
LSPEVEHRPF TPEEDDTIIR AHARFGNKWA TISRLLNGRT DNAIKNHWNS TLKRKFSSMS  120
DDMSPEHQPL KRSASVGAGT TVSGLYLNPG SPSGSDLSDS SLPGVIPHSQ AAFRPVAMTV  180
APPVEPVALA VAVDPPTSLS LSLPGSNEGR THQRSASGSG SSWIVSPKPK VVHQPQVIQV  240
QPQEAEAAAA AAAAAAAAAR VGKQNSSEVG IDKQFFTAEF LDVMQEMIRT EVRNYMSGIE  300
HKGMMMHTEA AIKNAVVKRI GISKVE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-401411657159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-401411657159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004291065.10.0PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW14e-93MYB44_ARATH; Transcription factor MYB44
TrEMBLM5XSK41e-149M5XSK4_PRUPE; Uncharacterized protein
STRINGPOPTR_0002s12410.11e-133(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF84334124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.19e-75myb domain protein r1